PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015874021.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family GRAS
Protein Properties Length: 689aa    MW: 78943.8 Da    PI: 5.1843
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015874021.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS364.61.3e-1113196873374
            GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlt 97 
                     +lL +cAeav++ d++ a+++L+++++++sp+gd +qRla+yf+ AL+ rla  +s ly +++++e s    +e l+ ++++ +++P+ k+s++ 
  XP_015874021.1 319 TLLNHCAEAVANYDKKTADEFLKQIRQHSSPYGDQTQRLAHYFAIALEVRLAA-SSPLYMTFASNERS---AAELLKGYQVYLNTCPFKKMSNFF 409
                     689*************************************************9.78888888887777...99********************** PP

            GRAS  98 aNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledle 190
                     aN++Il+ +e+++r+HiiDf+i +G QWp+L+q+L+sR++gpp lRiTg++ p++g   + ++eetg+rLa+++e+++vpfe+n  +a+++e+++
  XP_015874021.1 410 ANHTILKLAEKASRIHIIDFGILYGYQWPSLIQSLSSRTSGPPLLRITGIELPQPGfrPSGRVEETGRRLANYCERFNVPFEYNG-IAQKWETIR 503
                     *******************************************************9*99**************************.7******** PP

            GRAS 191 leeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikv 285
                     +e+L++++++ +aVn++ ++ +++de+v  + +rd vLkl+k+++P+++v++     +n++ Fl+rf eal+++sa+fd +ea+lpre+++r   
  XP_015874021.1 504 YEDLKIDRDDFIAVNCSSRMRHIPDETVLEDCPRDMVLKLIKEINPDIFVHSVVSGTYNAPIFLRRFKEALYHFSAFFDIYEATLPREDQQRLLF 598
                     **************************999999*************************************************************** PP

            GRAS 286 ErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     E e++g+++ nv+ace ++r+ r et+++W+ r  +aGF ++pl++++ k++k ++r  + + + v+e+  ++++gWk+r + ++S+W+
  XP_015874021.1 599 EIEVFGKDALNVIACESFQRIDRPETYKQWQVRNIRAGFMQLPLDQEILKKVKNMVRLDYHKDFVVDEDGMWMLQGWKGRIMEAFSCWK 687
                     ************************************************************888*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.91291667IPR005202Transcription factor GRAS
PfamPF035144.6E-109319687IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 689 aa     Download sequence    Send to blast
MDTHFRELSG TNQNLVHEFD VIHEVTNSRF LPAGSELPID HSSPSLDLSS SEADYPESRD  60
FSNAILRYIS EMLMEEEDLA DKPCMLQDCL ALQVAEKSLY DVIGKKHPSL NDQNIENIDV  120
KFGQSLGHQG NNKYVPTSNW LGSEGVSNGS IFEFSLIESP QDSLLVPDSS PDTQSISHSK  180
KGIRETGKGI RNGEIEVIDL ESRPSLPQEP RELEDGSFNS QSGSKGKKNH EREDDRDDLE  240
ERSNKQSTVD DESSVPQEMY DEVLLFQTGS QETETSALHD KMKIEKGKLQ SYKQPKGSNV  300
KKAQQKKQYN TSELVDLWTL LNHCAEAVAN YDKKTADEFL KQIRQHSSPY GDQTQRLAHY  360
FAIALEVRLA ASSPLYMTFA SNERSAAELL KGYQVYLNTC PFKKMSNFFA NHTILKLAEK  420
ASRIHIIDFG ILYGYQWPSL IQSLSSRTSG PPLLRITGIE LPQPGFRPSG RVEETGRRLA  480
NYCERFNVPF EYNGIAQKWE TIRYEDLKID RDDFIAVNCS SRMRHIPDET VLEDCPRDMV  540
LKLIKEINPD IFVHSVVSGT YNAPIFLRRF KEALYHFSAF FDIYEATLPR EDQQRLLFEI  600
EVFGKDALNV IACESFQRID RPETYKQWQV RNIRAGFMQL PLDQEILKKV KNMVRLDYHK  660
DFVVDEDGMW MLQGWKGRIM EAFSCWKPA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-393216878375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015874021.10.0PREDICTED: scarecrow-like protein 34
TrEMBLM5W3910.0M5W391_PRUPE; Uncharacterized protein
STRINGGLYMA11G14670.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-175GRAS family protein